Website stats for Lavaart - lavaart.com
Choose your shipping destination! norwayswedenfinlanddenmarkgermanyaustriairelandnetherlandseuunited kindom - Coming Soonusa - Coming Soonbelgium - Coming Soonswiss - Coming Soonfrance - Coming Soonhungary - Coming Soonestonia - Coming Soonpoland - Coming Soonlithuania - Coming Soon If your country is not on the list, unfortunately, we do not currently ship to your country. Please check back frequ...
lavaart.com was registered 2 decades 1 year ago. It has a alexa rank of #2,122,156 in the world. It is a domain having .com extension. It is estimated worth of $ 720.00 and have a daily income of around $ 3.00. As no active threats were reported recently, lavaart.com is SAFE to browse.
Traffic Report
| Daily Unique Visitors: | 413 |
| Daily Pageviews: | 826 |
Estimated Valuation
| Income Per Day: | $ 3.00 |
| Estimated Worth: | $ 720.00 |
Search Engine Indexes
| Google Indexed Pages: | Not Applicable |
| Yahoo Indexed Pages: | Not Applicable |
| Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
| Google Backlinks: | Not Applicable |
| Bing Backlinks: | Not Applicable |
| Alexa BackLinks: | Not Applicable |
Safety Information
| Google Safe Browsing: | No Risk Issues |
| Siteadvisor Rating: | Not Applicable |
| WOT Trustworthiness: |
 Very Poor
|
| WOT Privacy: |
Very Poor
|
| WOT Child Safety: |
Very Poor
|
Website Ranks & Scores
| Alexa Rank: | 2,122,156 |
| PageSpeed Score: | 89 ON 100 |
| Domain Authority: |
49 ON 100 
|
| Bounce Rate: | Not Applicable |
| Time On Site: | Not Applicable |
Web Server Information
Hosted IP Address:
104.18.10.171
Hosted Country:
US
Location Latitude:
37.7757Location Longitude:
-122.395Traffic Classification
| Total Traffic: | 85.30K |
| Direct Traffic: | 22.50% |
| Referral Traffic: | 0.69% |
| Search Traffic: | 20.68% |
| Social Traffic: | 56.13% |
| Mail Traffic: | 0% |
| Display Traffic: | 0% |
Search Engine Results For lavaart.com
Lava Art Cosmetic – Nature's finest ingredients blended into ...
Please check back frequently if your country is not listed, as we continue to expand our list of destination countries. Skip to content. lavaart-logo-default.
Lava Art Finland – Luonnon hienoimmat ainesosat luovat yhdessä ...
Lähetä meille sähköpostia! YHTEYSTIEDOT. Lava Art AS. Co/ Directhouse Arendal AS. Bjørumsvegen 15, Postboks 19.
Tuotteet – Lava Art Finland - Lava Art Cosmetic
Lähetä meille sähköpostia! YHTEYSTIEDOT. Lava Art AS. Co/ Directhouse Arendal AS. Bjørumsvegen 15, Postboks 19.
Lava Art Europe – Nature's finest ingredients blended into cosmetic...
Free Shipping on Purchases over 80 Euro! By using lavaart.com you agree that we use cookies to increase the user experience. For further details, please read ...
Kuinka voin ottaa yhteyttä tehin? – Lava Art Finland
27. marraskuu 2018 ... Lähetä meille sähköpostia! YHTEYSTIEDOT. Lava Art AS. Co/ Directhouse Arendal AS. Bjørumsvegen 15, Postboks 19.
Products – Lava Art Europe - Lava Art Cosmetic
Perfect Toner + Perfect Facial Cream - Save 20% with this bundle.
KAUPAN EHDOT – Lava Art Finland - Lava Art Cosmetic
(Norjan yritystunnus: 917148996). Yksityisyys Tutustu Tietosuojaselosteeseemme, joka myös ohjaa vierailuasi Lava Art AS:llä auttaen sinua ymmärtämään ...
About – Lava Art Europe - Lava Art Cosmetic
Welcome to the LAVA ART way of life. Always natural. Always cruelty-free. HISTORY. Cosmetics with a Nordic heart ...
About – Lava Art Finland - Lava Art Cosmetic
Tervetuloa elämään, niin kuin LAVA ART sen näkee. Aina luonnollisesti. Aina ilman julmuutta. HISTORIA. Kosmetiikkaa pohjoisella sydämellä.
Thank you – Lava Art Finland - Lava Art Cosmetic
Näin saat suosikkisi Lava Art -tuotteista aina tarvitessasi. Tarjotaksemme optimoiduimman ja saumattomimman ostokokemuksen, liitämme ostoosi automaattisen ...
Login – Lava Art Europe - Lava Art Cosmetic
When you place your first order at Lava Art, you will automatically be registered as a member - so there's no need to sign up first! go to shop. lavaart-logo-default.
Login – Lava Art Finland - Lava Art Cosmetic
Oletko kauneusbloggaaja? Haluaisitko mukaan mainosvideoillemme? Lähetä meille sähköpostia! YHTEYSTIEDOT. Lava Art AS. Co/ Directhouse Arendal AS.
Matte Compact Cushion – Lava Art Finland - Lava Art Cosmetic
Minusta ei tuntunut siltä kuin olisin käyttänyt sitä, ja se on vain ehdottoman ylivoimainen kaikilla tavoilla. Voin todella suositella. BACK. NEXT. lavaart-logo- ...
Perfect Blender – Lava Art Finland - Lava Art Cosmetic
Monikäyttöinen häivytyssienemme on lateksiton ja sopii pitkäaikaiseen käyttöön nestemäisen ja kuivan kosmetiikan kanssa. Sienen ergonominen muoto tekee ...
Keskustelu - Lava art, kokemuksia? | Aihe vapaa | Vauva
5. toukokuu 2019 ... Vierailija: "Onko kukaan tilannut tätä ihme meikkivoidetta? Mainos tulee jatkuvasti vastaan mutta mitään arvioita tm.ei löydy ainakaan suomeksi ...
Lava Art Cosmetic Reviews | Read Customer Service Reviews of ...
Do you agree with Lava Art Cosmetic's 4-star rating? Check out what 208 people have written so far, and share your own experience.
Lava Art Cosmetic (@lavaartcosmetic) • Instagram photos and videos
- https://www.instagram.com/lavaartcosmetic/
Lava Art Cosmetic. Vegan Cruelty-Free ✨Skin-loving effortless beauty✨ Click the link to shop www.lavaart.com. Skincare ✨'s profile picture. Skincare ...
Lava Art Cosmetic (LavaArtCosmetic) - Profile | Pinterest
Lava Art Cosmetic | Nature is our source of beauty and inspiration. Putting the environment first is a mindset deeply rooted in every part of Lava Art.
Lava Art - Home | Facebook
Lava Art · August 28, 2018 ·. Lavasta syntyikin kiva seinähylly takkahuoneeseen. Valojen kans on kiva leikkiä. Eiks jee . The stage turned into a nice wall shelf ...
Lava Art AS Company Profile | FROLAND, AGDER, Norway ...
Find company research, competitor information, contact details & financial data for Lava Art AS of FROLAND, AGDER. Get the latest business insights from Dun ...
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
| H1 Headings: | Not Applicable | H2 Headings: | 2 |
| H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
| H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
| Total IFRAMEs: | 1 | Total Images: | 10 |
| Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Two Phrase Analysis
| Words | Occurrences | Density | Possible Spam |
|---|---|---|---|
| Coming Soon | 18 | 6.294 % | No |
| your country | 6 | 2.098 % | No |
| country is | 4 | 1.399 % | No |
| is not | 4 | 1.399 % | No |
| to your | 3 | 1.049 % | No |
| Shop About | 3 | 1.049 % | No |
| your shipping | 3 | 1.049 % | No |
| Lava Art | 3 | 1.049 % | No |
| shipping destination | 3 | 1.049 % | No |
| ship to | 2 | 0.699 % | No |
| Please check | 2 | 0.699 % | No |
| check back | 2 | 0.699 % | No |
| currently ship | 2 | 0.699 % | No |
| country Please | 2 | 0.699 % | No |
| unfortunately we | 2 | 0.699 % | No |
| list unfortunately | 2 | 0.699 % | No |
| the list | 2 | 0.699 % | No |
| back frequently | 2 | 0.699 % | No |
| we do | 2 | 0.699 % | No |
| do not | 2 | 0.699 % | No |
Four Phrase Analysis
| Words | Occurrences | Density | Possible Spam |
|---|---|---|---|
| your country is not | 4 | 1.399 % | No |
| do not currently ship | 2 | 0.699 % | No |
| we do not currently | 2 | 0.699 % | No |
| unfortunately we do not | 2 | 0.699 % | No |
| not currently ship to | 2 | 0.699 % | No |
| list unfortunately we do | 2 | 0.699 % | No |
| ship to your country | 2 | 0.699 % | No |
| currently ship to your | 2 | 0.699 % | No |
| to your country Please | 2 | 0.699 % | No |
| on the list unfortunately | 2 | 0.699 % | No |
| If your country is | 2 | 0.699 % | No |
| Soon If your country | 2 | 0.699 % | No |
| Coming Soon If your | 2 | 0.699 % | No |
| country is not on | 2 | 0.699 % | No |
| is not on the | 2 | 0.699 % | No |
| your country Please check | 2 | 0.699 % | No |
| not on the list | 2 | 0.699 % | No |
| the list unfortunately we | 2 | 0.699 % | No |
| country Please check back | 2 | 0.699 % | No |
| to expand our list | 2 | 0.699 % | No |
HTTP Header Analysis
Status-Code: 200
Status: 200 OK
Date: Wed, 17 Mar 2021 23:24:32 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
CF-Ray: 6319f9abedd6d46b-HAM
Cache-Control: max-age=0, no-cache, s-maxage=10
Link:
Vary: Accept-Encoding
CF-Cache-Status: BYPASS
cf-apo-via: origin,page-rules
cf-request-id: 08e41a5f710000d46b79948000000001
Expect-CT: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
Referrer-Policy: no-referrer-when-downgrade
X-Frame-Options: SAMEORIGIN
X-Mod-Pagespeed: 1.13.35.2-0
Server: cloudflare
Content-Encoding: gzip
alt-svc: h3-27=":443"; ma=86400, h3-28=":443"; ma=86400, h3-29=":443"; ma=86400
Domain Information
| Domain Registrar: |
One.com A/S
|
|---|---|
| Registration Date: | 2004-01-27 2 decades 1 year 1 week ago |
| Last Modified: | 2020-12-28 4 years 1 month 2 weeks ago |
Domain Nameserver Information
| Host | IP Address | Country | |
|---|---|---|---|
| grace.ns.cloudflare.com | |
173.245.58.159 | United States |
DNS Record Analysis
| Host | Type | TTL | Extra |
|---|---|---|---|
| lavaart.com | A | 280 |
IP: 104.18.11.171 |
| lavaart.com | A | 280 |
IP: 104.18.10.171 |
| lavaart.com | NS | 86400 |
Target: grace.ns.cloudflare.com |
| lavaart.com | NS | 86400 |
Target: sam.ns.cloudflare.com |
| lavaart.com | SOA | 3600 |
MNAME: grace.ns.cloudflare.com RNAME: dns.cloudflare.com Serial: 2036755724 Refresh: 10000 Retry: 2400 Expire: 604800 |
| lavaart.com | MX | 300 |
Priority: 5 Target: aspmx.l.google.com |
| lavaart.com | MX | 300 |
Priority: 1 Target: aspmx.l.google.com |
| lavaart.com | MX | 300 |
Priority: 10 Target: alt3.aspmx.l.google.com |
| lavaart.com | MX | 300 |
Priority: 10 Target: alt4.aspmx.l.google.com |
| lavaart.com | MX | 300 |
Priority: 5 Target: alt2.aspmx.l.google.com |
| lavaart.com | TXT | 300 |
TXT: v=spf1 a mx ip4:217.170.197.183 a:oslo.directhouse.no ~all |
| lavaart.com | TXT | 300 |
TXT: google-site-verification=OqisICaTwqrLgXz ectOc0zrhuDye1cLRYSvVlVfMI3c |
| lavaart.com | TXT | 300 |
TXT: facebook-domain-verification=f9edsc7ubxx rwrw21xj2kybf21ggzy |
| lavaart.com | AAAA | 254 |
IPV6: 2606:4700::6812:bab |
| lavaart.com | AAAA | 254 |
IPV6: 2606:4700::6812:aab |
Top Organic Keyword
| 1. | lava art cosmetic |
| 2. | lava art sverige |
| 3. | lavaart |
| 4. | translucent loose setting powder |
| 5. | lava art |
Top Paid Keyword
| 1. | lava art |
| 2. | najlepsze gabki do makijazu |
| 3. | cosmetica natural |
| 4. | body foundation |
| 5. | ingredients naturales para productos de cosmetica |
Full WHOIS Lookup
Registry Domain ID:
110661217_DOMAIN_COM-VRSN
Registrar WHOIS Server:
whois.one.com
Registrar URL: http://www.one.com
Updated Date:
2020-12-28T00:46:08Z
Creation Date:
2004-01-27T02:09:01Z
Registry Expiry Date:
2022-01-27T02:09:01Z
Registrar: One.com A/S
Registrar IANA ID:
1462
Registrar Abuse Contact Email: [email protected]
Registrar
Abuse Contact Phone: +45 46907100
Domain Status: ok
https://icann.org/epp#ok
Name Server:
GRACE.NS.CLOUDFLARE.COM
Name Server:
SAM.NS.CLOUDFLARE.COM
DNSSEC: unsigned
URL of the ICANN Whois
Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last
update of whois database: 2021-03-17T23:24:27Z
Similarly Ranked Websites
402 Payment Required
Как сделать мультик? Бесплатное обучение и курсы 2d анимации по программе Anime Studio Pro 10/11 (Moho Pro 12) от Александр Птичкина
2,122,158 
$ 720.00
BFit Gyms | The Gym Famous For Sharing - The Gym Famous For Sharing
Reach your fitness goals at BFit Gyms and pass fit on with our Shareable Gym Membership. Great Equipment. Great Hours. Great Rate. Friendliest Gym near you.
2,122,182 $ 720.00
Mens Luxury Outerwear | North & Mark
Outerwear built for urban life. North & Mark outerwear combines classic style with technical performance for stylish functionality and superior comfort.
2,122,188 $ 720.00